Monday, September 14, 2015

Product Focus: Avanti® Mini-Extruder




The Avanti Mini-Extruder allows researchers and scientists to prepare large, unilamellar vesicles by extrusion in an efficient, rapid manner. The holder/heating block allows the extrusion of unilamellar vesicles at elevated temperatures, which is critical for the successful production of vesicles from phospholipids with a phase transition temperature above room temperature. Constructed of stainless steel and Teflon, this new design allows rapid cleaning of all wetted parts, which reduces the “down-time” between production of vesicles from different lipid species. The Mini-Extruder is available for a fraction of the cost of a larger extruder. All parts for the Mini-Extruder are available from Avanti, and the Mini-Extruder comes with a 30 day workmanship guarantee.


Kits

The Avanti  Mini-Extruder allows researchers and scientists to prepare large, unilamellar vesicles by extrusion (LUVET) in an efficient, rapid manner.

Extruder Set With Holder/Heating Block (610000)

Mini-Extruder (set): includes instructions, mini-extruder, 2 syringes, 100 PC membranes,
100 filter supports, and 1 holder/heating block

Extruder Set Without Holder/Heating Block (610023)

Mini-Extruder (set): includes instructions, mini-extruder, 2 syringes, 100 PC membranes, and 100 filter supports

Filter Support (610014)

10mm Filter Supports (100/pk)
For use with the extruder to provide extra support and improved flow rate. It provides a flat surface to eliminate tearing or rupturing of the polycarbonate membrane. It is also used as a separator between membrane layers in serial stack filtration applications. The polyester filter support is binder free and has a thickness of 100 µm. The filter support disc is chemically inert.

Polycarbonate Membranes

  • 610002 – 0.03μm 19mm (100/pk)
  • 610003 – 0.05μm 19mm (100/pk)
  • 610005 – 0.1μm 19mm (100/pk)
  • 610006 – 0.2μm 19mm (100/pk)
  • 610007 – 0.4μm 19mm (100/pk)
  • 610009 – 0.8μm 19mm (100/pk)
  • 610010 – 1.0μm 19mm (100/pk)



 Where can I find more information about Avanti Polar Lipids Inc.?Visit the manufacturer page at www.stratech.co.uk/avanti-polar-lipids, email info@stratech.co.uk or call +44 (0) 1638 782600.

Stratech Scientific is a distributor of high quality, competitively priced, reliable products for research laboratories throughout the UK and Europe. Please contact us to find out which ranges we can supply in your country.

Supplier Focus: Jena Bioscience – Affinity Chromatography Products

The ability to purify recombinant proteins using affinity chromatography has greatly advanced protein research.  In affinity chromatography, the protein of interest is purified by its ability to bind a specific ligand that is immobilized on a chromatographic bead material (matrix).  Crude cell-lysates are incubated with such a matrix under conditions that ensure specific binding of the protein to the immobilized ligand. Other proteins that do not bind the immobilized ligand are washed through. Elution of the bound protein of interest can be achieved by changing the experimental conditions to favour desirption.

Jena Bioscience offers both Agarose and Magnetic Beads (or Magnetic Agarose Beads) as matrix for different purification tasks.

The available products follow the grouping below, for further information contact info@stratech.co.uk or search our website.

Purification of

Agarose

Magnetic Beads

Nucleotide-binding proteins NTP/NDP/NMP Agaroses
mRNA cap binding proteins m7GTP Agarose
ATP-binding proteins ATP Agaroses
ATP Affinity Test Kit
ATP Affinity Purification Kits

AMP-binding proteins AMP Agaroses
AMP Affinity Test Kit

Poly(A)-binding proteins Poly(A)-Agarose
Phospho Amino Acid binding proteins O-Phospho-Serine Agarose
O-Phospho-Threonine Agarose
O-Phospho-Tyrosine Agarose

GST-tagged proteins Glutathione Agarose Glutathione Magnetic Beads
His-tagged proteins Ni-NTA Agarose
Ni-IDA Agarose
Co-IDA Agarose
Ni-, Zn-, Co-, Cu-IDA Agarose (gravity flow)
Ni-NTA Magnetic Beads
Co-NTA Magnetic Beads
Ni-IDA Magnetic Beads
Co-IDA Magnetic Beads
Antibodies Protein A Agarose
mAB-Protein A Agarose (alkali-stable)
Protein G Agarose
Protein A/G Agarose

CLICK-functionalized proteins Azide Agarose
Alkyne Agarose
DBCO Agarose
Azide Magnetic Beads
Alkyne Magnetic Beads
DBCO Magnetic Beads


Jena Bioscience also offer additional chromatography equipment, such as empty columns, spin columns and cartridges. Use your preferred bulk resins and pack your own columns, tailor-made for your particular application.
  • Basic Columns:  Empty polypropylene columns for affinity chromatography
  • Spin Columns:  Empty polypropylene columns for affinity chromatography by syringe or by centrifugation with small amounts of resin
  • Reusable FPLC Columns:  Empty polypropylene columns for affinity chromatography by FPLC and ÄktaTM design chromatography systems
  • Single-use FPLC Columns:  Empty, single-use polypropylene columns for affinity chromatography by FPLC and ÄktaTM design chromatography systems



Where can I find more information about Jena Bioscience?

Visit the manufacturer page at www.stratech.co.uk/jena_bioscience, email info@stratech.co.uk or call +44 (0) 1638 782600.

Stratech Scientific is a distributor of high quality, competitively priced, reliable products for research laboratories throughout the UK and Europe. Please contact us to find out which ranges we can supply in your country.

Biosensis’s Key Antibodies for Neurological Disease Research: Presenilins & Nicastrin

Biosensis has a number of highly published antibodies for your research into neurological diseases. Below we highlight four of our most popular Presenilin and Nicastrin antibodies

PRESENILIN


Rabbit polyclonal antibody to Presenilin 1 (1-20)
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Catalogue No.  R-1605-500 (Data SheetMSDS): A synthetic peptide corresponding to a region (1-20 aa) from the N-terminus of human Presenilin 1 conjugated to Diptheria toxoid.

Rabbit Polyclonal Presenilin 2 Loop Region
Autosomal dominant mutations in presenilin 2 are the second major cause of early-onset familial Alzheimer’s disease. Presenilin 2 is a multi-transmembrane protein which undergoes endoprotelysis to form an N-terminal fragment of about 29 kDa and C-terminal fragment of about 22 kDa. Presenilin 2 forms the catalytic core of the gamma-secretase complex which cleaves type 1 transmembrane proteins including the amyloid precursor protein to generate the C-terminus of the amyloid beta peptide.
Catalogue No.  R-1681-500 (Data SheetMSDS): A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.

References
  1. M.X. Silveyra et al (2008) Presenilin-1 interacts with acetylcholinesterase and alters its enzymatic activity and glycosylation. Mol. Cell Biol. 210, 788-792.
  2. J.G. Culvenor et al (2004) Characterization of Presenilin complexes from mouse and human brain using Blue Native gel electrophoresis reveals high expression in embryonic brain and minimal change in complex mobility with pathogenic presenilin mutations. Eur. J. Biochem. 271, 375-385.
  3. N.T. Ilaya et al (2004) Nicastrin expression in mouse peripheral tissues is not co-ordinated with Presenilin and is high in muscle. J. Neurochem. 91, 230-237.
  4. D. Beher et al (2003) In vitro Characterization of the Presenilin-dependent gamma-secretase complex using a novel affinity ligand. Biochem. 42, 8133-8142.
  5. G. Evin et al (2002) Alternative transcripts of Presenilin-1 associated with Frontotemporal  Dementia. NeuroReport 13, 917-921.
  6. G. Evin et at (2001) Aspartyl protease inhibitor pepstatin binds to the presenilins of Alzheimer’s disease. Biochem. 40, 8359-8368.

NICASTRIN

Nicastrin, a type 1 membrane glycoprotein, is an essential component of the gamma secretase complex which is critical for the cleavage of the amyloid precursor protein and other membrane proteins. Nicastrin is widely expressed in different tissue types. This antibody reacts with immature forms of Nicastrin.

Rabbit polyclonal antibody to Nicastrin, central region
Detection of higher mol. wt. mature forms is likely to be blocked by glycosylation in this region of the protein.
Catalogue No.  R-1685-500 (Data SheetMSDS): A synthetic peptide (C-QGETFDYIGSSRMVYD) corresponding to human Nicastrin [331-346] in the central region conjugated via additional N-terminal Cys to Diphtheria toxoid.

Rabbit polyclonal antibody to Nicastrin, C-terminal domain
Catalogue No.  R-1684-500 (Data SheetMSDS): A synthetic peptide (C-NAKADVLFIAPREPGAVSY) corresponding to human Nicastrin [691-709] in the C-terminal region conjugated via additional N-terminal Cys to Diphtheria toxoid.


References
  1. 1. J.G. Culvenor et al (2004) Characterization of Presenilin complexes from mouse and human brain using Blue Native gel electrophoresis reveals high expression in embryonic brain and minimal change in complex mobility with pathogenic Presenilin mutations. Eur. J. Biochem. 271, 375-385.
  2. N.T. Ilaya et al (2004) Nicastrin expression in mouse peripheral tissues is not co-ordinated with Presenilin and is high in muscle. J. Neurochem. 91, 230-237.
  3. D. Beher et al (2003) In vitro Characterization of the Presenilin-dependent gamma-secretase complex using a novel affinity ligand. Biochem. 42, 8133-8142.



Where can I find more information about Biosensis?

Visit the manufacturer page at www.stratech.co.uk/biosensis, email info@stratech.co.uk or call +44 (0) 1638 782600.

Stratech Scientific is a distributor of high quality, competitively priced, reliable products for research laboratories throughout the UK and Europe. Please contact us to find out which ranges we can supply in your country.